PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q8L9B5 to PF04535 (DUF588)

SwissProt::Q8L9B5 has 182 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    7.9e-48  148.2   9.1    1.1e-47  147.8   9.1    1.2  1  SwissProt::Q8L9B5  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q8L9B5  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  147.8   9.1   1.1e-47   1.1e-47       2     150 .]       6     155 ..       5     155 .. 0.98

  Alignments for each domain:
  == domain 1  score: 147.8 bits;  conditional E-value: 1.1e-47
             DUF588   2 rklrvaelvLRlaavvlalaaavvmatnkqtkevfkiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkk.ersaalalllfll 92 
                        r++r++el+LR++  v+al+a+++++t+++ k +f+i+++ak++d++a v+lvvan+iaavYsllq v++vv  +++k   s+ la+++f +
  SwissProt::Q8L9B5   6 RRMRLTELLLRCSISVFALLALILVVTDTEVKLIFTIKKTAKYTDMKAVVFLVVANGIAAVYSLLQSVRCVVGTMKGKvLFSKPLAWAFFSG 97 
                        7899**************************************************************************************** PP

             DUF588  93 DqvlaylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafll 150
                        Dq++ayl ++A +A+a+   +a++g++ +qW+ +C ++gkFc+++a+ v+ ++la+++
  SwissProt::Q8L9B5  98 DQAMAYLNVAAIAATAESGVIAREGEEDLQWMRVCTMYGKFCNQMAIGVSSALLASIA 155
                        *******************************************************985 PP



Or compare SwissProt::Q8L9B5 to CDD or PaperBLAST