PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9FFT2 to PF04535 (DUF588)

SwissProt::Q9FFT2 has 194 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    6.7e-36  109.5   3.4    8.8e-36  109.1   3.4    1.1  1  SwissProt::Q9FFT2  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9FFT2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  109.1   3.4   8.8e-36   8.8e-36       3     149 ..      28     165 ..      26     166 .. 0.95

  Alignments for each domain:
  == domain 1  score: 109.1 bits;  conditional E-value: 8.8e-36
             DUF588   3 klrvaelvLRlaavvlalaaavvmatnkqtkevfkiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllfllDq 94 
                        +l++++ +LRl++v l++a++++ +tn+++++ +   ++ +++++  ++y+v+++ai+a+Y+ll++v s+v      ++  ++a+l+f+ Dq
  SwissProt::Q9FFT2  28 SLKIIDSCLRLSVVPLSVATIWLTVTNHESNPDY---GNLEYNSIMGLKYMVGVSAISAIYALLSTVSSWV------TCLVSKAWLFFIPDQ 110
                        78999*************************9997...9********************************8......5666799******** PP

             DUF588  95 vlaylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafl 149
                        vlay+++++++ a+++vyl++kg++ ++W+++C++++++c + ++a+ l+++ ++
  SwissProt::Q9FFT2 111 VLAYVMTTSVAGATEIVYLLNKGDKIVTWSEMCSSYPHYCSKLTIALGLHVFVLF 165
                        *************************************************998765 PP



Or compare SwissProt::Q9FFT2 to CDD or PaperBLAST