PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9M0L3 to PF04535 (DUF588)

SwissProt::Q9M0L3 has 170 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.4e-38  118.3  16.3    1.9e-38  117.8  16.3    1.1  1  SwissProt::Q9M0L3  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9M0L3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  117.8  16.3   1.9e-38   1.9e-38       7     150 .]      17     155 ..      14     155 .. 0.96

  Alignments for each domain:
  == domain 1  score: 117.8 bits;  conditional E-value: 1.9e-38
             DUF588   7 aelvLRlaavvlalaaavvmatnkqtkevfkiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllfllDqvlay 98 
                        +++++R++++++a+a+++vm+tn++  +v+ i +eak+s+++af+ylv+a++++++ +l++lv ++ +++     ++ l+++lf++D++++ 
  SwissProt::Q9M0L3  17 VQVSMRVLTIGAAMASMWVMITNREVASVYGIAFEAKYSYSSAFRYLVYAQIAVCAATLFTLVWACLAVR-----RRGLVFALFFFDLLTTL 103
                        7899************************************************************998774.....4679************* PP

             DUF588  99 lllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafll 150
                          +sA sAa+a  y++k+gn++a+Wl+iC  ++ +c rv++++a+sf++f+l
  SwissProt::Q9M0L3 104 TAISAFSAAFAEGYVGKYGNKQAGWLPICGYVHGYCSRVTISLAMSFASFIL 155
                        *************************************************986 PP



Or compare SwissProt::Q9M0L3 to CDD or PaperBLAST