PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9SQU2 to PF04535 (DUF588)

SwissProt::Q9SQU2 has 199 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      7e-45  138.7   5.3      9e-45  138.3   5.3    1.1  1  SwissProt::Q9SQU2  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9SQU2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  138.3   5.3     9e-45     9e-45       4     149 ..      34     184 ..      32     185 .. 0.96

  Alignments for each domain:
  == domain 1  score: 138.3 bits;  conditional E-value: 9e-45
             DUF588   4 lrvaelvLRlaavvlalaaavvmatnkqtkevf......kiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalll 89 
                        +r+++++ R++ + ++l+a++vm+t++qt++++       ++v+a+f+d+paf+y+vva ++a++Y+l+++++s+  l++  e +a+  ++l
  SwissProt::Q9SQU2  34 CRKIDIITRVLLFSATLTALIVMVTSDQTEMTQlpgvssPAPVSAEFNDSPAFIYFVVALVVASFYALISTLVSISLLLK-PEFTAQFSIYL 124
                        7899*************************9999******************************************77765.4888899**** PP

             DUF588  90 fllDqvlaylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafl 149
                        + lD+v++++l+sA+++a +v+y+a kgn+e++W+kiCn+++kFc+ +a+++als++a+l
  SwissProt::Q9SQU2 125 ASLDMVMLGILASATGTAGGVAYIALKGNEEVGWNKICNVYDKFCRYIATSLALSLFASL 184
                        **********************************************************97 PP



Or compare SwissProt::Q9SQU2 to CDD or PaperBLAST