PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9SUP0 to PF04535 (DUF588)

SwissProt::Q9SUP0 has 197 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    2.1e-44  137.1   9.0    3.3e-44  136.5   9.0    1.3  1  SwissProt::Q9SUP0  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9SUP0  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  136.5   9.0   3.3e-44   3.3e-44       3     150 .]      14     168 ..      12     168 .. 0.96

  Alignments for each domain:
  == domain 1  score: 136.5 bits;  conditional E-value: 3.3e-44
             DUF588   3 klrvaelvLRlaavvlalaaavvmatnkqtkevf.........kiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaal 85 
                        k +++ l LR++a++++laaa+vm +nk+tk+++         k++++akf+++pafv++v+an+++++++ll++v++++s +   e +  +
  SwissProt::Q9SUP0  14 KSWKLLLGLRIFAFMATLAAAIVMSLNKETKTLVvatigtvpiKATLTAKFQHTPAFVFFVIANVMVSFHNLLMIVVQIFSRKL--EYKGLR 103
                        5677899*************************99*********************************************87766..788889 PP

             DUF588  86 alllfllDqvlaylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafll 150
                        +l +++lD++ a+l+ +Aa Aa+ v++l+k+gn++a+W+k+C+ f+++c++ a+a++++f++++l
  SwissProt::Q9SUP0 104 LLSIAILDMLNATLVSAAANAAVFVAELGKNGNKHAKWNKVCDRFTTYCDHGAGAIIAAFAGVIL 168
                        9************************************************************9985 PP



Or compare SwissProt::Q9SUP0 to CDD or PaperBLAST