PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9XI72 to PF04535 (DUF588)

SwissProt::Q9XI72 has 209 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    3.1e-46  143.1   4.6    3.7e-46  142.8   4.6    1.1  1  SwissProt::Q9XI72  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9XI72  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  142.8   4.6   3.7e-46   3.7e-46       2     150 .]      46     194 ..      45     194 .. 0.96

  Alignments for each domain:
  == domain 1  score: 142.8 bits;  conditional E-value: 3.7e-46
             DUF588   2 rklrvaelvLRlaavvlalaaavvmatnkqtkevf..kiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllfl 91 
                        ++++v+++vLRl+av+ ++ +a+ m+t++++++     + +++k+sdlp+++++vvanai+ +Y +l+l++s++++++  +++++++++l++
  SwissProt::Q9XI72  46 KGISVLGFVLRLFAVFGTIGSALAMGTTHESVVSLsqLVLLKVKYSDLPTLMFFVVANAISGGYLVLSLPVSIFHIFS--TQAKTSRIILLV 135
                        567899************************7666699999*************************************9..88889******* PP

             DUF588  92 lDqvlaylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafll 150
                        +D+v+++l+ s+asAa+a vyla++gn+ a+W +iC+qf+ Fcer++++++ sf+a++l
  SwissProt::Q9XI72 136 VDTVMLALVSSGASAATATVYLAHEGNTTANWPPICQQFDGFCERISGSLIGSFCAVIL 194
                        ********************************************************985 PP



Or compare SwissProt::Q9XI72 to CDD or PaperBLAST