PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9ZT81 to PF04535 (DUF588)

SwissProt::Q9ZT81 has 164 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      8e-46  141.7   9.2      1e-45  141.4   9.2    1.1  1  SwissProt::Q9ZT81  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9ZT81  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  141.4   9.2     1e-45     1e-45       5     150 .]       7     143 ..       3     143 .. 0.96

  Alignments for each domain:
  == domain 1  score: 141.4 bits;  conditional E-value: 1e-45
             DUF588   5 rvaelvLRlaavvlalaaavvmatnkqtkevfkiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllfllDqvl 96 
                        r+ +lvLRlaa+++alaa++vm+t++++ ++  i++eak++d+ af+y+v+ana+++vYs+l l+l           ++ l+ ++++lD+v+
  SwissProt::Q9ZT81   7 RIGGLVLRLAAFGAALAALIVMITSRERASFLAISLEAKYTDMAAFKYFVIANAVVSVYSFLVLFLPK---------ESLLWKFVVVLDLVM 89 
                        6789**************************************************************55.........556899********* PP

             DUF588  97 aylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafll 150
                        ++ll+s+ sAa+av++++kkgn +a+Wl+iC q++kFc+++++a+++ f+a++l
  SwissProt::Q9ZT81  90 TMLLTSSLSAALAVAQVGKKGNANAGWLPICGQVPKFCDQITGALIAGFVALVL 143
                        ***************************************************985 PP



Or compare SwissProt::Q9ZT81 to CDD or PaperBLAST