PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10089712 to PF04535 (DUF588)

VIMSS10089712 has 221 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
      4e-46  142.7   6.8    4.9e-46  142.4   6.8    1.1  1  VIMSS10089712  


Domain annotation for each sequence (and alignments):
>> VIMSS10089712  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  142.4   6.8   4.9e-46   4.9e-46       2     149 ..      57     204 ..      56     205 .. 0.98

  Alignments for each domain:
  == domain 1  score: 142.4 bits;  conditional E-value: 4.9e-46
         DUF588   2 rklrvaelvLRlaavvlalaaavvmatnkqtkevf..kiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllfllDqv 95 
                    r+++++++vLRl+a+++a+aaa+ mat+++t+++f  ++q++a+++dlp+   +v++n+i+ +Y  l+l++s+v+++r  + +   +l+l+l+D+v
  VIMSS10089712  57 RGVAIFDFVLRLIAAITAMAAAAKMATTEETLPFFtqFLQFQADYTDLPTMSSFVIVNSIVGGYLTLSLPFSIVCILR--PLAVPPRLFLILCDTV 150
                    67899************************************************************************9..99************** PP

         DUF588  96 laylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafl 149
                    +++l+l AasA+aa+vyla++gns+ +Wl++C+qfg+Fc+ +++av++sf+a+ 
  VIMSS10089712 151 MMGLTLMAASASAAIVYLAHNGNSSSNWLPVCQQFGDFCQGTSGAVVASFIAAT 204
                    ***************************************************986 PP



Or compare VIMSS10089712 to CDD or PaperBLAST