PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10090730 to PF04535 (DUF588)

VIMSS10090730 has 206 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
      2e-48  150.1   9.0    2.8e-48  149.7   9.0    1.2  1  VIMSS10090730  


Domain annotation for each sequence (and alignments):
>> VIMSS10090730  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  149.7   9.0   2.8e-48   2.8e-48       2     149 ..      43     190 ..      42     191 .. 0.98

  Alignments for each domain:
  == domain 1  score: 149.7 bits;  conditional E-value: 2.8e-48
         DUF588   2 rklrvaelvLRlaavvlalaaavvmatnkqtkevf..kiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllfllDqv 95 
                    r+l++++++LRlaa+++++ aa+vm t+++t+++f  ++q++a ++dlpaf+y+v+a a++a Y +l+l++s+vs+vr  +++ a +l+l+++D++
  VIMSS10090730  43 RGLAIFDFLLRLAAIAVTIGAASVMYTAEETLPFFtqFLQFQAGYDDLPAFQYFVIAVAVVASYLVLSLPFSIVSIVR--PHAVAPRLILLICDTL 136
                    67899*************************************************************************..**************** PP

         DUF588  96 laylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafl 149
                    +++l +sAa+Aaa+++yla++gn++++Wl+iC+qfg+Fc++v++av++  +a+l
  VIMSS10090730 137 VVTLNTSAAAAAASITYLAHNGNQSTNWLPICQQFGDFCQNVSTAVVADSIAIL 190
                    ************************************************999987 PP



Or compare VIMSS10090730 to CDD or PaperBLAST