PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10091117 to PF04535 (DUF588)

VIMSS10091117 has 178 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.1e-26   79.6   5.3    1.4e-26   79.3   5.3    1.1  1  VIMSS10091117  


Domain annotation for each sequence (and alignments):
>> VIMSS10091117  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   79.3   5.3   1.4e-26   1.4e-26       3     149 ..      12     157 ..      10     158 .. 0.92

  Alignments for each domain:
  == domain 1  score: 79.3 bits;  conditional E-value: 1.4e-26
         DUF588   3 klrvaelvLRlaavvlalaaavvmatnkqtkevfkiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllfllDqvlay 98 
                    +lr++ l+LR++++++ l+++v++ tn+ t+e+++++ +  f+d+ a++y++ a++i+ vY+++ql+l++ +++++k   +    ++f +D v++y
  VIMSS10091117  12 TLRTVLLLLRVLTAAFLLITVVLISTNTVTLEISSTSIKLPFNDVYAYRYMLSAAVIGLVYAVVQLFLTISQFATGK-THPLTYQFDFYGDKVISY 106
                    57899********************************************************************9986.3446899*********** PP

         DUF588  99 lllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafl 149
                    ll+++++A ++v++ +k+   ++   +  + ++kF  +  a+ +l ++af+
  VIMSS10091117 107 LLATGSAAGFGVSKDLKDTYIALIEFDSTDPVDKFFSKGYASASLLLFAFV 157
                    ****************9886665555578999****************997 PP



Or compare VIMSS10091117 to CDD or PaperBLAST