PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10093298 to PF04535 (DUF588)

VIMSS10093298 has 204 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
      1e-48  151.1   7.4    1.3e-48  150.8   7.4    1.1  1  VIMSS10093298  


Domain annotation for each sequence (and alignments):
>> VIMSS10093298  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  150.8   7.4   1.3e-48   1.3e-48       2     150 .]      41     189 ..      40     189 .. 0.98

  Alignments for each domain:
  == domain 1  score: 150.8 bits;  conditional E-value: 1.3e-48
         DUF588   2 rklrvaelvLRlaavvlalaaavvmatnkqtkevf..kiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllfllDqv 95 
                    r+l++++++LRlaa+v+alaaa+ m+t+++t+++f  ++q+ea+++dlp+f+++v+a+a++ +Y +l+l++svv ++r  + ++a +lll++lD+ 
  VIMSS10093298  41 RGLAIFDFLLRLAAIVAALAAAATMGTSDETLPFFtqFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTILR--PLATAPRLLLLVLDTG 134
                    678999***********************************************************************9..9999************ PP

         DUF588  96 laylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafll 150
                    +++l ++Aas+aaa++yla++gn++++Wl+iC+qfg+Fc++ ++av+ +f+++++
  VIMSS10093298 135 VLALNTAAASSAAAISYLAHSGNQNTNWLPICQQFGDFCQKSSGAVVSAFVSVVF 189
                    ***************************************************9985 PP



Or compare VIMSS10093298 to CDD or PaperBLAST