PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10093654 to PF04535 (DUF588)

VIMSS10093654 has 178 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    5.6e-36  109.8  12.4    7.2e-36  109.4  12.4    1.2  1  VIMSS10093654  


Domain annotation for each sequence (and alignments):
>> VIMSS10093654  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  109.4  12.4   7.2e-36   7.2e-36       3     149 ..      19     158 ..      17     172 .. 0.95

  Alignments for each domain:
  == domain 1  score: 109.4 bits;  conditional E-value: 7.2e-36
         DUF588   3 klrvaelvLRlaavvlalaaavvmatnkqtkevfkiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllfllDqvlay 98 
                    + ++ae vLR+a ++l+++ +v+m+ n+ ++e+    +++++s++ af+ylv an+++a+Ysll++++     +   + s+ ++ +lfllDqv++y
  VIMSS10093654  19 TEKSAEAVLRVASMALSITGLVIMIKNSISNEF----GSVSYSNIGAFMYLVSANGVCAAYSLLSALAILALPC---PISKVQVRTLFLLDQVVTY 107
                    56789****************************....9***************************999664333...8999*************** PP

         DUF588  99 lllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafl 149
                    ++l+A + +a+ vyla++gn  ++W+++C+++g+Fc+++ ++v+++f+ +l
  VIMSS10093654 108 VVLAAGAVSAETVYLAYYGNIPITWSSACDSYGSFCHNALISVVFTFVVSL 158
                    ***********************************************9876 PP



Or compare VIMSS10093654 to CDD or PaperBLAST