PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10101095 to PF04535 (DUF588)

VIMSS10101095 has 193 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    6.3e-46  142.1   9.2    7.7e-46  141.8   9.2    1.1  1  VIMSS10101095  


Domain annotation for each sequence (and alignments):
>> VIMSS10101095  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  141.8   9.2   7.7e-46   7.7e-46       2     150 .]      24     176 ..      23     176 .. 0.94

  Alignments for each domain:
  == domain 1  score: 141.8 bits;  conditional E-value: 7.7e-46
         DUF588   2 rklrvaelvLRlaavvlalaaavvmatnkqtkevf.....kiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllfll 92 
                    ++++++++vLR++ ++++l+++vvm+t+kqtk++f         +a+f+++pa++y+vva ++a++Ys+++++++v +++ k+++sa l+l l+++
  VIMSS10101095  24 KSCSMTQVVLRFVLFAATLTSIVVMVTSKQTKNIFlpgtpIRIPAAEFTNSPALIYFVVALSVACFYSIVSTFVTVSAFK-KHSCSAVLLLNLAIM 118
                    57899********************************996444589******************************7764.4599*********** PP

         DUF588  93 DqvlaylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafll 150
                    D v++++++sA++A  +v+yl+ kgn+e++W kiC+ ++kFc++v +a+a+s++a+++
  VIMSS10101095 119 DAVMVGIVASATGAGGGVAYLGLKGNKEVRWGKICHIYDKFCRHVGGAIAVSLFASVV 176
                    *******************************************************985 PP



Or compare VIMSS10101095 to CDD or PaperBLAST