PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10101096 to PF04535 (DUF588)

VIMSS10101096 has 190 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    3.9e-42  129.8   3.8    5.4e-42  129.3   3.8    1.1  1  VIMSS10101096  


Domain annotation for each sequence (and alignments):
>> VIMSS10101096  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  129.3   3.8   5.4e-42   5.4e-42       5     150 .]      25     177 ..      22     177 .. 0.96

  Alignments for each domain:
  == domain 1  score: 129.3 bits;  conditional E-value: 5.4e-42
         DUF588   5 rvaelvLRlaavvlalaaavvmatnkqtkevf..........kiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllf 90 
                    + +el +R++a++l++aaa+v++++kqtk+v+           i+++ak s+l+afvy + +naia++Y+++++++ ++s     +rs++l+++++
  VIMSS10101096  25 KGVELTMRVLALILTMAAATVLGVAKQTKVVSikliptlpplDITTTAKASYLSAFVYNISVNAIACGYTAISIAILMISRG---RRSKKLLMVVL 117
                    6799************************************************************************996554...68889****** PP

         DUF588  91 llDqvlaylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafll 150
                    l+D+v+++ll+s+++Aa a+  ++ +gn+++ W+k+C +fgkFc+r+a ++ l++la+++
  VIMSS10101096 118 LGDLVMVALLFSGTGAASAIGLMGLHGNKHVMWKKVCGVFGKFCHRAAPSLPLTLLAAVV 177
                    *********************************************************985 PP



Or compare VIMSS10101096 to CDD or PaperBLAST