PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10101097 to PF04535 (DUF588)

VIMSS10101097 has 190 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
      5e-44  135.9   6.8      6e-44  135.7   6.8    1.0  1  VIMSS10101097  


Domain annotation for each sequence (and alignments):
>> VIMSS10101097  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  135.7   6.8     6e-44     6e-44       4     150 .]      24     177 ..      21     177 .. 0.95

  Alignments for each domain:
  == domain 1  score: 135.7 bits;  conditional E-value: 6e-44
         DUF588   4 lrvaelvLRlaavvlalaaavvmatnkqtkevf..........kiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalll 89 
                     + +el +R++a+vl+++aa+v++++kqtk+v           +++++ak s+l+afvy + anaia++Y+++++v+ ++s     +rs++l++++
  VIMSS10101097  24 RKGLELTMRVLALVLTMVAATVLGVAKQTKVVPikliptlpplNVSTTAKASYLSAFVYNISANAIACGYTAISIVIVMISK---GKRSKSLLMAV 116
                    57789***************************9********************************************99543...378899***** PP

         DUF588  90 fllDqvlaylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafll 150
                    +++D+++++ll+s+++Aa a+  ++++gn+++ W+k+C +fgkFc+++a++va++++a+++
  VIMSS10101097 117 LIGDLMMVALLFSSTGAAGAIGLMGRHGNKHVMWKKVCGVFGKFCNQAAVSVAITLIASVV 177
                    **********************************************************985 PP



Or compare VIMSS10101097 to CDD or PaperBLAST