PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10104547 to PF04535 (DUF588)

VIMSS10104547 has 202 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.2e-48  150.9  10.3    1.5e-48  150.6  10.3    1.1  1  VIMSS10104547  


Domain annotation for each sequence (and alignments):
>> VIMSS10104547  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  150.6  10.3   1.5e-48   1.5e-48       2     149 ..      39     186 ..      38     187 .. 0.98

  Alignments for each domain:
  == domain 1  score: 150.6 bits;  conditional E-value: 1.5e-48
         DUF588   2 rklrvaelvLRlaavvlalaaavvmatnkqtkevf..kiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllfllDqv 95 
                    r+l++++++LRlaa+v+alaaa+ m+t+++t+++f  ++q+ea+++dlp+f+++vva ai+a+Y +l+l++svv +vr  + + a +lll++lD++
  VIMSS10104547  39 RGLSIFDFLLRLAAIVAALAAAATMGTSDETLPFFtqFLQFEASYDDLPTFQFFVVAIAIVAGYLVLSLPFSVVTIVR--PLAVAPRLLLLVLDTA 132
                    67899************************************************************************9..999************* PP

         DUF588  96 laylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafl 149
                     ++l ++AasAaaa+vyla++gn++++Wl+iC+qfg+Fc+++++av+ +f+++ 
  VIMSS10104547 133 ALALDTAAASAAAAIVYLAHNGNTNTNWLPICQQFGDFCQKTSGAVVSAFASVT 186
                    **************************************************9985 PP



Or compare VIMSS10104547 to CDD or PaperBLAST