PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10105476 to PF04535 (DUF588)

VIMSS10105476 has 187 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.6e-52  163.5   4.9    1.9e-52  163.2   4.9    1.1  1  VIMSS10105476  


Domain annotation for each sequence (and alignments):
>> VIMSS10105476  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  163.2   4.9   1.9e-52   1.9e-52       2     150 .]      23     171 ..      22     171 .. 0.97

  Alignments for each domain:
  == domain 1  score: 163.2 bits;  conditional E-value: 1.9e-52
         DUF588   2 rklrvaelvLRlaavvlalaaavvmatnkqtkevf..kiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllfllDqv 95 
                    r+++++e++LR++a++ ++ +a++m+t+++t+++f  +i+++a+++dlpa++++vvana++++Y +l+l l++v++v+  +++++ ++ll++lD++
  VIMSS10105476  23 RRIAILEFILRIVAFFNTIGSAILMGTTHETLPFFtqFIRFQAEYNDLPALTFFVVANAVVSGYLILSLTLAFVHIVK--RKTQNTRILLIILDVA 116
                    678899***********************************************************************9..666679********** PP

         DUF588  96 laylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafll 150
                    +++ll+s+as+aaa+vyla++gn++++W +iC+qf++Fcer++++++ sf+a++l
  VIMSS10105476 117 MLGLLTSGASSAAAIVYLAHNGNNKTNWFAICQQFNSFCERISGSLIGSFIAIVL 171
                    ****************************************************985 PP



Or compare VIMSS10105476 to CDD or PaperBLAST