PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS9956214 to PF04535 (DUF588)

VIMSS9956214 has 162 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.2e-39  120.3  12.6      4e-39  120.0  12.6    1.1  1  VIMSS9956214  


Domain annotation for each sequence (and alignments):
>> VIMSS9956214  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  120.0  12.6     4e-39     4e-39       4     149 ..       5     141 ..       2     142 .. 0.95

  Alignments for each domain:
  == domain 1  score: 120.0 bits;  conditional E-value: 4e-39
        DUF588   4 lrvaelvLRlaavvlalaaavvmatnkqtkevfkiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllfllDqvlayll 100
                    r+++ vLRlaa+++a+aaa++m+t+++t+++f i++eak+s++p+fv++vva a+a++Ysll+l++            +++  ll+l D+++ +ll
  VIMSS9956214   5 HRLISAVLRLAAAGAAAAAAIIMVTSHETTSFFGIEMEAKYSYTPSFVFFVVAFAVAFAYSLLALLARP---------GSTASRLLLLSDVMVGMLL 92 
                   6899*************************************************************9976.........2246788999********* PP

        DUF588 101 lsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafl 149
                   + A++A+ a+++++k+gn++a+Wl+iC q++++c +v +a+++ f+++l
  VIMSS9956214  93 TGAVAATGAISQVGKSGNEHAGWLPICAQVQAYCSHVMGALIAGFVSLL 141
                   *********************************************9987 PP



Or compare VIMSS9956214 to CDD or PaperBLAST