PaperBLAST – Find papers about a protein or its homologs

 

Align XP_015638091.1 to PF04535 (DUF588)

XP_015638091.1 has 162 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.5e-39  121.3  17.8      2e-39  121.0  17.8    1.2  1  XP_015638091.1  


Domain annotation for each sequence (and alignments):
>> XP_015638091.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  121.0  17.8     2e-39     2e-39       4     149 ..       5     141 ..       2     142 .. 0.95

  Alignments for each domain:
  == domain 1  score: 121.0 bits;  conditional E-value: 2e-39
          DUF588   4 lrvaelvLRlaavvlalaaavvmatnkqtkevfkiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllfllDqvlay 98 
                      r+++ vLRlaa+++a++aavvm+t+++t+++f iq+eak+s++p+f+++vva a+aa+Ysll l++ +          +al  l ++ D+vl +
  XP_015638091.1   5 HRLMNAVLRLAAAAAAATAAVVMVTSRETTSFFGIQMEAKYSYTPSFIFFVVAYAVAAAYSLLVLAVPAG---------SALSRLALTTDVVLGM 90 
                     688999*************************************************************993.........347788999******* PP

          DUF588  99 lllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafl 149
                     +l+ A+++a a++++ak+gns+a+Wl++C q +++c++v aa+++ f+a++
  XP_015638091.1  91 VLAGAVASAGAISDIAKNGNSHAGWLPVCGQIHAYCNHVMAALIAGFVALA 141
                     ************************************************987 PP



Or compare XP_015638091.1 to CDD or PaperBLAST