PaperBLAST – Find papers about a protein or its homologs

 

Align XP_021848329.1 to PF04535 (DUF588)

XP_021848329.1 has 190 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.8e-36  109.7   9.0    7.1e-36  109.4   9.0    1.1  1  XP_021848329.1  


Domain annotation for each sequence (and alignments):
>> XP_021848329.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  109.4   9.0   7.1e-36   7.1e-36       5     149 ..       4     154 ..       1     155 [. 0.94

  Alignments for each domain:
  == domain 1  score: 109.4 bits;  conditional E-value: 7.1e-36
          DUF588   5 rvaelvLRlaavvlalaaavvmatnkqtkevf.kiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkk.....ersaalalllfllD 93 
                      ++e +LRl+a+++ l+aa+vm+t++qtk++f  ++++a+++  + +++ v++  i+a+Y+llqlv+++  +++ +      +s+ l ++ f lD
  XP_021848329.1   4 IKIEAILRLCALLTLLLAAIVMMTDNQTKTFFgYYKMRADYKLAKILKVSVYVYLIGAGYTLLQLVRCMAFMTKYEgdklsCSSHILKWFYFSLD 98 
                     57899***************************99*********************************996665555999*988889********* PP

          DUF588  94 qvlaylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafl 149
                     qv ay++++ ++A+++++ l+ +g + +qW+k+C+++ +Fc ++ +++a+  +a++
  XP_021848329.1  99 QVAAYVVFAIVCATLEISFLVLTGSKDLQWMKLCSKYVRFCVQIGGSIACGGVASI 154
                     **************************************************999887 PP



Or compare XP_021848329.1 to CDD or PaperBLAST