PaperBLAST – Find papers about a protein or its homologs

 

Align CAZy::CAJ47425.1 to PF04577 (DUF563)

CAZy::CAJ47425.1 has 512 amino acids

Query:       DUF563  [M=209]
Accession:   PF04577.14
Description: Protein of unknown function (DUF563)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------         -----------
    7.7e-24   71.1   0.0    2.3e-23   69.6   0.0    1.8  2  CAZy::CAJ47425.1  


Domain annotation for each sequence (and alignments):
>> CAZy::CAJ47425.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    3.4   0.0    0.0041    0.0041      52     110 ..     212     268 ..     204     271 .. 0.88
   2 !   69.6   0.0   2.3e-23   2.3e-23       3     206 ..     241     488 ..     238     491 .. 0.81

  Alignments for each domain:
  == domain 1  score: 3.4 bits;  conditional E-value: 0.0041
            DUF563  52 ekrikveldepvhveklivpvpprssggfqgallpklrdrlrerlnlekrkkptrvlyi 110
                        +r++ + + +++ve+  +pv+ +  ++ ++    ++++ + +r++  + ++p +v+++
  CAZy::CAJ47425.1 212 STRVVPPVHCSQWVEEPTLPVTRFEYASLFHTITDWYSAYVSSRVTNLP-DRP-NVVFV 268
                       567767788999*********************************9999.899.88897 PP

  == domain 2  score: 69.6 bits;  conditional E-value: 2.3e-23
            DUF563   3 ygHwlvdvlprlllleqlvlddd.drilvpalaspqpfqrellkllgirpekrikveldepvhveklivpvpprssggfqgallp........ 86 
                       + H ++d+ + ++  + + l d  ++++v+   + ++ ++e++++l       +      pv+++++i++  ++  + f+g  ++        
  CAZy::CAJ47425.1 241 F-HTITDWYSAYVSSRVTNLPDRpNVVFVDG--HCKAQLEETWEALF--SSVTYAKNFTVPVCFRHAILSPLGYETAMFKGLSESfscegasv 328
                       4.99****99996666666555526666888..99999999**4433..356665777799*************8888888888888889888 PP

            DUF563  87 ................klrdrlrerlnlekr........kkptrvlyisR........lkag..sRrilNeeevl....kllp..krgfevvd 139
                                       ++ +++ ++++l +         ++  +vl++ R        ++ g    r++Ne+ev     k  +  k +++v +
  CAZy::CAJ47425.1 329 dslrekpdyektarlsEFGEMIVASFDLLQDdimsskksNG-LNVLFVRRedylahprHS-GkvESRLSNEQEVYdaidKWAQglKCKVNVAN 419
                       88889999999999999999999999999889998765433.477788887777655333.2699*********8777744442245577777 PP

            DUF563 140 ..peslsfeeqiklfssakvivgphGsgltnliFmppgttvielvppnrldnsfenlaallglkyayvl 206
                         +++++++eq++   +a+v++g hG+glt+l+ + p+t+v+e++++ +++++f  +++++ l+y+++ 
  CAZy::CAJ47425.1 420 glFAHMTMKEQLRAILEASVVIGAHGAGLTHLVSATPDTKVLEIISSMYRRPHFALISHWKSLEYHAIN 488
                       99******************************************999999999*************985 PP



Or compare CAZy::CAJ47425.1 to CDD or PaperBLAST