PaperBLAST – Find papers about a protein or its homologs

 

Align CAZy::CCA61105.1 to PF04577 (DUF563)

CAZy::CCA61105.1 has 506 amino acids

Query:       DUF563  [M=209]
Accession:   PF04577.14
Description: Protein of unknown function (DUF563)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------         -----------
    1.2e-25   77.0   0.0    2.1e-25   76.2   0.0    1.3  1  CAZy::CCA61105.1  


Domain annotation for each sequence (and alignments):
>> CAZy::CCA61105.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   76.2   0.0   2.1e-25   2.1e-25       4     190 ..     212     415 ..     209     435 .. 0.80

  Alignments for each domain:
  == domain 1  score: 76.2 bits;  conditional E-value: 2.1e-25
            DUF563   4 gHwlvdv.lprlllleqlvlddddrilvpalaspqpfqrellkllgi.rpekrikveldepvhveklivpvppr.......ssggfqgallp. 86 
                       +H  +dv +p +++  +++ + +  +lv++    + + +++l+++++ ++ + i+++ d +v+++  +v+ p +        s          
  CAZy::CCA61105.1 212 FHDYTDVlVPAFITAHRFGGEVQ--FLVSS--FKSWWTNRYLEIFQQlSRHEVIDIDNDDEVRCYGSVVVGPTFhkelgvdASK-------Tp 293
                       47788884555566666666666..77777..777899999999999999999*9**********9999999995555543333.......13 PP

            DUF563  87 ......klrdrlrerlnlekr............kkptrvlyisRlkagsRrilNeeevlkllp..krgfevvdpe.slsfeeqiklfssakvi 158
                              +r++lr +++l++             ++p r+l+isR  ++sR +lNe ++++     ++ ++v +p+ +  +   ++l++sa+v+
  CAZy::CCA61105.1 294 tgasmvDFRAMLRGAFGLSRAaaepsgdrwdirRRP-RLLIISR--KNSRAFLNERAMADMAMslGYDVRVGEPDtNTEVSRFARLVNSADVM 383
                       455566**********************99998888.*******..99**********955551266666778997888************** PP

            DUF563 159 vgphGsgltnliFmppgttvielvppnrldns 190
                       vg+hG+gltn++F+p g+++i ++p ++l++ 
  CAZy::CCA61105.1 384 VGVHGAGLTNMVFLPAGAVLIQVIPYGGLEWL 415
                       *********************99988777755 PP



Or compare CAZy::CCA61105.1 to CDD or PaperBLAST