PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001012384.2 to PF04577 (DUF563)

NP_001012384.2 has 585 amino acids

Query:       DUF563  [M=209]
Accession:   PF04577.14
Description: Protein of unknown function (DUF563)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      4e-24   72.0   0.1    1.2e-23   70.5   0.0    1.8  2  NP_001012384.2  


Domain annotation for each sequence (and alignments):
>> NP_001012384.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   70.5   0.0   1.2e-23   1.2e-23       3     205 ..     170     397 ..     168     401 .. 0.76
   2 ?   -3.3   0.0      0.44      0.44      35      70 ..     462     497 ..     449     521 .. 0.54

  Alignments for each domain:
  == domain 1  score: 70.5 bits;  conditional E-value: 1.2e-23
          DUF563   3 ygHwlvdvlprl.llleqlvlddd.dril.vpalaspqpfqrellkllgirpekrikveldepvhveklivpvpprssggfqgallp........ 86 
                       H ++d l +  ++++q    dd  r++ +      +    +l++ll   ++  +   +d+  ++ kl + + ++ + +    +++        
  NP_001012384.2 170 LMHIFHDDLLPVyYTMQQYSDLDDeARLVfMEG--WGEGAHFDLYRLLSS-KQPLL---KDQLKTFGKLMCFTKSYVGLSKMTTWYQygfvqpqg 258
                     568888886666366666666666644442333..555555578888888.77777...446667777777777775555555555555555666 PP

          DUF563  87 .............klrdrlrerlnlekr....kkptrvlyisRlkagsRrilNeeevl....kllpkrgfevvdpeslsfeeqiklfssakvivg 160
                                  +++ +l+erln+++     +    ++++ R  + +R ilNe+e+l    ++++ r++ +v++e+ sf   i++ s a ++v+
  NP_001012384.2 259 pkanilisgneirQFASFLMERLNITREeeeeDD-DYIVVFKR--TTNRLILNEAELLlalaQEFQMRTV-TVSLEEQSFDNIIQIISRAAMLVS 349
                     6899999999999**************8776433.6999****..************9755555555554.577********************* PP

          DUF563 161 phGsgltnliFmppgttvielvppnrldns....fenlaallglkyayv 205
                     +hG+++  ++F+p+g++v+el +p ++++     + +la+l g++  yv
  NP_001012384.2 350 MHGAQMITSMFLPRGAAVVEL-FPYGVNPEqytpYKTLASLPGMDLQYV 397
                     *********************.888888888899999999988877665 PP

  == domain 2  score: -3.3 bits;  conditional E-value: 0.44
          DUF563  35 spqpfqrellkllgirpekrikveldepvhve.kliv 70 
                     s  + +r+ lk l++ ++ ++  + ++ +  e k+++
  NP_001012384.2 462 SFLDVLRDGLKKLNL-KKAKVASTVHPGRVREpKCQT 497
                     555778888988999.666665665533333343333 PP



Or compare NP_001012384.2 to CDD or PaperBLAST