PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q5NDE5 to PF04577 (DUF563)

SwissProt::Q5NDE5 has 578 amino acids

Query:       DUF563  [M=209]
Accession:   PF04577.14
Description: Protein of unknown function (DUF563)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    3.8e-24   72.1   0.1    1.1e-23   70.5   0.0    1.8  2  SwissProt::Q5NDE5  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q5NDE5  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   70.5   0.0   1.1e-23   1.1e-23       3     205 ..     163     390 ..     161     394 .. 0.76
   2 ?   -3.2   0.0      0.43      0.43      35      70 ..     455     490 ..     442     514 .. 0.54

  Alignments for each domain:
  == domain 1  score: 70.5 bits;  conditional E-value: 1.1e-23
             DUF563   3 ygHwlvdvlprl.llleqlvlddd.dril.vpalaspqpfqrellkllgirpekrikveldepvhveklivpvpprssggfqgallp..... 86 
                          H ++d l +  ++++q    dd  r++ +      +    +l++ll   ++  +   +d+  ++ kl + + ++ + +    +++     
  SwissProt::Q5NDE5 163 LMHIFHDDLLPVyYTMQQYSDLDDeARLVfMEG--WGEGAHFDLYRLLSS-KQPLL---KDQLKTFGKLMCFTKSYVGLSKMTTWYQygfvq 248
                        568888886666366666666666644442333..555555578888888.77777...446667777777777775555555555555555 PP

             DUF563  87 ................klrdrlrerlnlekr....kkptrvlyisRlkagsRrilNeeevl....kllpkrgfevvdpeslsfeeqiklfss 154
                                        +++ +l+erln+++     +    ++++ R  + +R ilNe+e+l    ++++ r++ +v++e+ sf   i++ s 
  SwissProt::Q5NDE5 249 pqgpkanilisgneirQFASFLMERLNITREeeeeDD-DYIVVFKR--TTNRLILNEAELLlalaQEFQMRTV-TVSLEEQSFDNIIQIISR 336
                        6666899999999999**************8776433.6999****..************9755555555554.577*************** PP

             DUF563 155 akvivgphGsgltnliFmppgttvielvppnrldns....fenlaallglkyayv 205
                        a ++v++hG+++  ++F+p+g++v+el +p ++++     + +la+l g++  yv
  SwissProt::Q5NDE5 337 AAMLVSMHGAQMITSMFLPRGAAVVEL-FPYGVNPEqytpYKTLASLPGMDLQYV 390
                        ***************************.888888888899999999988877665 PP

  == domain 2  score: -3.2 bits;  conditional E-value: 0.43
             DUF563  35 spqpfqrellkllgirpekrikveldepvhve.kliv 70 
                        s  + +r+ lk l++ ++ ++  + ++ +  e k+++
  SwissProt::Q5NDE5 455 SFLDVLRDGLKKLNL-KKAKVASTVHPGRVREpKCQT 490
                        555778888988999.666665665533333343333 PP



Or compare SwissProt::Q5NDE5 to CDD or PaperBLAST