SwissProt::Q5NDE5 has 578 amino acids
Query: Glyco_transf_61 [M=136]
Accession: PF04577.18
Description: Glycosyltransferase 61
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-17 50.4 0.1 4.1e-17 49.0 0.1 1.8 1 SwissProt::Q5NDE5
Domain annotation for each sequence (and alignments):
>> SwissProt::Q5NDE5
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 49.0 0.1 4.1e-17 4.1e-17 37 136 .] 265 361 .. 243 361 .. 0.86
Alignments for each domain:
== domain 1 score: 49.0 bits; conditional E-value: 4.1e-17
Glyco_transf_61 37 lglaklrkllrakfnlskikptryvyisRkksgkRrilNeeellealkkefggikfeivdpeklsleeqvklfssakvivgphGSaltnlif 128
+ ++l+++l + + ++ ++ +v+++R +++R ilNe+ell al +ef ++ ++v +e+ s++ +++ s a ++v++hG+++ +++f
SwissProt::Q5NDE5 265 QFASFLMERLNITREEEEEDDDYIVVFKR--TTNRLILNEAELLLALAQEF-QMRTVTVSLEEQSFDNIIQIISRAAMLVSMHGAQMITSMF 353
44455666666666666666677888888..9******************9.699************************************* PP
Glyco_transf_61 129 mppgtvvv 136
+p+g+ vv
SwissProt::Q5NDE5 354 LPRGAAVV 361
****9987 PP
Or compare SwissProt::Q5NDE5 to CDD or PaperBLAST