PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q5NDL2 to PF04577 (DUF563)

SwissProt::Q5NDL2 has 527 amino acids

Query:       DUF563  [M=209]
Accession:   PF04577.14
Description: Protein of unknown function (DUF563)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.2e-31   96.6   0.7    1.7e-31   96.1   0.7    1.3  1  SwissProt::Q5NDL2  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q5NDL2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   96.1   0.7   1.7e-31   1.7e-31       1     207 [.     245     470 ..     245     472 .. 0.75

  Alignments for each domain:
  == domain 1  score: 96.1 bits;  conditional E-value: 1.7e-31
             DUF563   1 nnygHwlvdvlprlllleqlvlddddrilvpalaspq...pfqrellkllgirpekrikve.ld.epvhve............klivpvppr 75 
                        n+y H ++d++  +++       ++d+++v    s++   + + +++++  ++  + i+++ +d ++v+++             l + +p+ 
  SwissProt::Q5NDL2 245 NMY-HHFCDFINLYITQHVNNSFSTDVYIVMWDTSSYgygDLFSDTWNA--FTDYDVIHLKtYDsKRVCFKeavfsllprmryGLFYNTPLI 333
                        689.******8777666666555556666433223334578888***44..44455555552333666666666666666665555555555 PP

             DUF563  76 ssggfqgallpklrdrlrerlnlekrkkp....trvlyisRlkagsRrilNeeevl...kllpkrgfevvd..peslsfeeqiklfssakvi 158
                         sg+ + +l+++++++++ rln+++  +p    +rv+++ R ++ +R+ilN++e++   k +  +++++vd    +l f +q+++ ++++++
  SwissProt::Q5NDL2 334 -SGCQNTGLFRAFAQHVLHRLNITQE-GPkdgkIRVTILAR-STEYRKILNQNELVnalKTVSTFEVQIVDykYRELGFLDQLRITHNTDIF 422
                        .6666666667**************5.444566********.99***********9555555578899***66669**************** PP

             DUF563 159 vgphGsgltnliFmppgttvielvppnrldnsfenlaallglkyayvlg 207
                        +g+hG+glt+l+F+p  ++v el      ++++  la+l+g++y+ ++ 
  SwissProt::Q5NDL2 423 IGMHGAGLTHLLFLPDWAAVFEL-YNCEDERCYLDLARLRGVHYITWRR 470
                        **************999******.55566667*************9986 PP



Or compare SwissProt::Q5NDL2 to CDD or PaperBLAST