VIMSS1288764 has 162 amino acids
Query: YezG-like [M=146] Accession: PF04634.16 Description: Immunity protein YezG-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-56 176.5 4.5 2e-56 176.3 4.5 1.0 1 VIMSS1288764 Domain annotation for each sequence (and alignments): >> VIMSS1288764 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 176.3 4.5 2e-56 2e-56 1 145 [. 7 151 .. 7 152 .. 0.99 Alignments for each domain: == domain 1 score: 176.3 bits; conditional E-value: 2e-56 YezG-like 1 lkelYeeiaekiidmiPeeWekvylyaevledsgevyFyylkkesekliysheipekynvseeeykkllkeLyelikelreefkkeeqeaWtnltls 97 l+++Y+eia++i+ miP+eWekvy++a+v++++gev+F+y+k++se+l+y+++ip+++nvs++++k+++ ++y++++elre+fkke+ e+Wt+++++ VIMSS1288764 7 LSQMYNEIANEISGMIPVEWEKVYTIAYVDDEGGEVVFNYTKPGSEDLNYYSDIPKDCNVSKDIFKNSWFKVYRMFDELRETFKKEDLEPWTSCEFD 103 689********************************************************************************************** PP YezG-like 98 lkksGklkiefnyddllnseldsserkiiwkykklgilpeeekekell 145 ++++G+lk++f+y d+++ + +s ++++++ykk+gilp++e+e+e++ VIMSS1288764 104 FTRKGNLKVSFDYIDWIKLGFGPSGKENYYMYKKFGILPDMEYEMEEI 151 *********************************************998 PP
Or compare VIMSS1288764 to CDD or PaperBLAST