VIMSS10098444 has 796 amino acids
Query: DUF630 [M=59] Accession: PF04783.16 Description: Protein of unknown function (DUF630) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-30 90.7 4.7 1.1e-29 88.7 4.7 2.2 1 VIMSS10098444 Domain annotation for each sequence (and alignments): >> VIMSS10098444 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.7 4.7 1.1e-29 1.1e-29 1 59 [] 1 59 [. 1 59 [. 0.99 Alignments for each domain: == domain 1 score: 88.7 bits; conditional E-value: 1.1e-29 DUF630 1 MGcaaSklddeeavalCreRkrllkqaveaRyaLAaaHvaYlqSLrnvgaaLrrFaeee 59 MGcaaSkld+e+av++C++R+rl+k+av+aR++LAaaH++Y++SLr +g+aL+ Fa +e VIMSS10098444 1 MGCAASKLDNEDAVRRCKDRRRLMKEAVYARHHLAAAHADYCRSLRITGSALSSFASGE 59 *******************************************************9986 PP
Or compare VIMSS10098444 to CDD or PaperBLAST