NP_001078202.2 has 195 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-71 222.1 0.0 1.5e-70 221.5 0.0 1.2 1 NP_001078202.2 Domain annotation for each sequence (and alignments): >> NP_001078202.2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 221.5 0.0 1.5e-70 1.5e-70 9 126 .] 44 161 .. 33 161 .. 0.96 Alignments for each domain: == domain 1 score: 221.5 bits; conditional E-value: 1.5e-70 ALOG_dom 9 kalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrlraafeen 103 ++lsrye+qkrrdwntf qyl+n+rPPl+l+rcsgahvleflryldqfGktkvh++ c+ffG+++p+apc cPlrqawGsldaliGrlraafeen NP_001078202.2 44 NQLSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTHLCPFFGHPNPPAPCACPLRQAWGSLDALIGRLRAAFEEN 138 689******************************************************************************************** PP ALOG_dom 104 ggkaesnPfaaravrvylrevre 126 gg++e+nPf+aravr+ylrevr+ NP_001078202.2 139 GGSPETNPFGARAVRLYLREVRD 161 **********************8 PP
Or compare NP_001078202.2 to CDD or PaperBLAST