NP_001142841.2 has 200 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-71 223.2 0.0 6.2e-71 222.7 0.0 1.2 1 NP_001142841.2 Domain annotation for each sequence (and alignments): >> NP_001142841.2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 222.7 0.0 6.2e-71 6.2e-71 6 126 .] 32 152 .. 27 152 .. 0.98 Alignments for each domain: == domain 1 score: 222.7 bits; conditional E-value: 6.2e-71 ALOG_dom 6 skPkalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrlraaf 100 +P++ srye+qkrrdwntf qyl+n+rPPl+la+csgahvleflryldqfGktkvh +ac+ffG+++p+apc cPlrqawGsldal+Grlraaf NP_001142841.2 32 MTPQSPSRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHGPACPFFGHPNPPAPCPCPLRQAWGSLDALVGRLRAAF 126 578899***************************************************************************************** PP ALOG_dom 101 eenggkaesnPfaaravrvylrevre 126 eengg++esnPfaaravr+ylrevre NP_001142841.2 127 EENGGRPESNPFAARAVRLYLREVRE 152 ************************97 PP
Or compare NP_001142841.2 to CDD or PaperBLAST