NP_001155193.2 has 247 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-71 222.3 0.2 1.5e-70 221.5 0.2 1.4 1 NP_001155193.2 Domain annotation for each sequence (and alignments): >> NP_001155193.2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 221.5 0.2 1.5e-70 1.5e-70 2 126 .] 41 165 .. 40 165 .. 0.98 Alignments for each domain: == domain 1 score: 221.5 bits; conditional E-value: 1.5e-70 ALOG_dom 2 ssseskPkalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrl 96 ++++ +P++lsryesqkrrdwntf+qyl+n+rPPl+larcsgahv+efl+yldqfGktkvha+ c++fGq++p+apc cPl+qawGsldaliGrl NP_001155193.2 41 AQAQPQPHQLSRYESQKRRDWNTFLQYLQNHRPPLTLARCSGAHVIEFLKYLDQFGKTKVHAAGCAHFGQPSPPAPCPCPLHQAWGSLDALIGRL 135 5778899**************************************************************************************** PP ALOG_dom 97 raafeenggkaesnPfaaravrvylrevre 126 raa+ee+g+ +esnPfaaravr+ylr+vr+ NP_001155193.2 136 RAAYEESGHAPESNPFAARAVRIYLRDVRD 165 *****************************8 PP
Or compare NP_001155193.2 to CDD or PaperBLAST