NP_001183622.1 has 247 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-72 225.8 0.1 1.1e-71 225.1 0.1 1.4 1 NP_001183622.1 Domain annotation for each sequence (and alignments): >> NP_001183622.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 225.1 0.1 1.1e-71 1.1e-71 2 126 .] 37 161 .. 36 161 .. 0.98 Alignments for each domain: == domain 1 score: 225.1 bits; conditional E-value: 1.1e-71 ALOG_dom 2 ssseskPkalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrl 96 ++++++P++lsryesqkrrdwntf+qyl+n+rPPl+larcsgahv+efl+yldqfGktkvha+ c++fGq++p+apc cPlrqawGsldaliGrl NP_001183622.1 37 PQQAAPPPQLSRYESQKRRDWNTFLQYLRNHRPPLTLARCSGAHVIEFLKYLDQFGKTKVHAAGCAYFGQPNPPAPCPCPLRQAWGSLDALIGRL 131 67888999*************************************************************************************** PP ALOG_dom 97 raafeenggkaesnPfaaravrvylrevre 126 raa+ee+g+ +esnPfaaravr+ylr+vr+ NP_001183622.1 132 RAAYEESGHAPESNPFAARAVRIYLRDVRD 161 *****************************8 PP
Or compare NP_001183622.1 to CDD or PaperBLAST