NP_198201.1 has 190 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-70 221.5 0.1 1.5e-70 221.5 0.1 1.7 2 NP_198201.1 Domain annotation for each sequence (and alignments): >> NP_198201.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 221.5 0.1 1.5e-70 1.5e-70 2 126 .] 14 138 .. 13 138 .. 0.98 2 ? -1.2 0.6 0.12 0.12 13 42 .. 147 172 .. 140 177 .. 0.69 Alignments for each domain: == domain 1 score: 221.5 bits; conditional E-value: 1.5e-70 ALOG_dom 2 ssseskPkalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrlraa 99 ss++ +P+++srye+qkrrdwntf+qyl+n+rPPl+l +csgahvleflryldqfGktkvh+++c+ffG ++p+apc cPlrqawGsldaliGrlraa NP_198201.1 14 SSTQLTPPSSSRYENQKRRDWNTFCQYLRNHRPPLSLPSCSGAHVLEFLRYLDQFGKTKVHHQNCAFFGLPNPPAPCPCPLRQAWGSLDALIGRLRAA 111 56677899****************************************************************************************** PP ALOG_dom 100 feenggkaesnPfaaravrvylrevre 126 +eengg +e+nPf++ravr++lrevr+ NP_198201.1 112 YEENGGPPEANPFGSRAVRLFLREVRD 138 **************************8 PP == domain 2 score: -1.2 bits; conditional E-value: 0.12 ALOG_dom 13 ryesqkrrdwntfvqylknkrPPlelarcs 42 +ye++++r + + +PPl+l++ + NP_198201.1 147 SYEKKRKR----VNRQKPQTQPPLQLQQQQ 172 56666666....556666788999988765 PP
Or compare NP_198201.1 to CDD or PaperBLAST