VIMSS10091480 has 177 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-71 222.2 0.0 1.2e-70 221.8 0.0 1.1 1 VIMSS10091480 Domain annotation for each sequence (and alignments): >> VIMSS10091480 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 221.8 0.0 1.2e-70 1.2e-70 3 126 .] 15 138 .. 13 138 .. 0.97 Alignments for each domain: == domain 1 score: 221.8 bits; conditional E-value: 1.2e-70 ALOG_dom 3 sseskPkalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrlra 98 s +++P + sryesqkrrdwntf qylkn+rPP+ +++cs++hvl+flryldqfGktkvh++ c+f+Gq+ep+apc+cPlrqawGsldaliGrlra VIMSS10091480 15 SGSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRA 110 556788999*************************************************************************************** PP ALOG_dom 99 afeenggkaesnPfaaravrvylrevre 126 a+eengg +e+nPfa+ a+rvylrevre VIMSS10091480 111 AYEENGGPPETNPFASGAIRVYLREVRE 138 **************************97 PP
Or compare VIMSS10091480 to CDD or PaperBLAST