VIMSS10101478 has 191 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-67 210.2 0.1 6.5e-67 209.7 0.1 1.2 1 VIMSS10101478 Domain annotation for each sequence (and alignments): >> VIMSS10101478 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 209.7 0.1 6.5e-67 6.5e-67 4 126 .] 30 151 .. 21 151 .. 0.95 Alignments for each domain: == domain 1 score: 209.7 bits; conditional E-value: 6.5e-67 ALOG_dom 4 seskPkalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrlraa 99 + ++P lsryesqkrrdwntfvqylk+++PPl++++++ +hvl+flryldqfGktkvh++acvffGq++p++pc+cPl+qawGsldaliGrlraa VIMSS10101478 30 QPQQP--LSRYESQKRRDWNTFVQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQPDPPGPCTCPLKQAWGSLDALIGRLRAA 123 34455..9**************************************************************************************** PP ALOG_dom 100 fee.nggkaesnPfaaravrvylrevre 126 +ee gg++++nPfa+ ++rv+lrevre VIMSS10101478 124 YEEhGGGSPDTNPFANGSIRVHLREVRE 151 ***667899*****************97 PP
Or compare VIMSS10101478 to CDD or PaperBLAST