VIMSS10110423 has 182 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-70 220.5 0.1 3.8e-70 220.1 0.1 1.1 1 VIMSS10110423 Domain annotation for each sequence (and alignments): >> VIMSS10110423 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 220.1 0.1 3.8e-70 3.8e-70 4 126 .] 13 133 .. 7 133 .. 0.95 Alignments for each domain: == domain 1 score: 220.1 bits; conditional E-value: 3.8e-70 ALOG_dom 4 seskPkalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrlraa 99 s+s+ sryesqkrrdwntf+qyl+n++PPl+l+rcsgahvlefl+yldqfGktkvha+ac+ffGq++p+++c+cPl+qawGsldaliGrlraa VIMSS10110423 13 SSSS---PSRYESQKRRDWNTFLQYLRNHKPPLNLSRCSGAHVLEFLKYLDQFGKTKVHATACPFFGQPNPPSQCTCPLKQAWGSLDALIGRLRAA 105 3444...5**************************************************************************************** PP ALOG_dom 100 fee.nggkaesnPfaaravrvylrevre 126 fee gg +esnPfaa+avr+yl+evr+ VIMSS10110423 106 FEEiGGGLPESNPFAAKAVRIYLKEVRQ 133 ***9999*******************96 PP
Or compare VIMSS10110423 to CDD or PaperBLAST