XP_004239743.1 has 211 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-68 214.1 0.0 4.5e-68 213.4 0.0 1.3 1 XP_004239743.1 Domain annotation for each sequence (and alignments): >> XP_004239743.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 213.4 0.0 4.5e-68 4.5e-68 8 126 .] 37 154 .. 30 154 .. 0.97 Alignments for each domain: == domain 1 score: 213.4 bits; conditional E-value: 4.5e-68 ALOG_dom 8 PkalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrlraafee 102 P lsrye+qkrrdwntf+qy++n++PPl+l +c +ah+leflryldqfGktkvh+++c+ffG +p+apc cPlrqawGsldaliGrlraa+ee XP_004239743.1 37 P-PLSRYENQKRRDWNTFCQYVRNHQPPLSLPQCTSAHILEFLRYLDQFGKTKVHNQNCPFFGLLNPPAPCPCPLRQAWGSLDALIGRLRAAYEE 130 3.59******************************************************************************************* PP ALOG_dom 103 nggkaesnPfaaravrvylrevre 126 nggk+e+nPf++r vr++lrevr+ XP_004239743.1 131 NGGKPEMNPFGSRNVRLFLREVRD 154 ***********************8 PP
Or compare XP_004239743.1 to CDD or PaperBLAST