XP_007205822.1 has 232 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-71 224.8 0.1 2.5e-71 223.9 0.1 1.4 1 XP_007205822.1 Domain annotation for each sequence (and alignments): >> XP_007205822.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 223.9 0.1 2.5e-71 2.5e-71 3 126 .] 44 167 .. 42 167 .. 0.97 Alignments for each domain: == domain 1 score: 223.9 bits; conditional E-value: 2.5e-71 ALOG_dom 3 sseskPkalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrlr 97 +++s+P+ sryesqkrrdwntf+qylkn++PPl+larcsgahv+efl+yldqfGktkvha+ c++fG+++p+apc cPl+qawGsldaliGrlr XP_007205822.1 44 EASSSPAPPSRYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHAAGCPYFGHPNPPAPCACPLKQAWGSLDALIGRLR 138 566788889************************************************************************************** PP ALOG_dom 98 aafeenggkaesnPfaaravrvylrevre 126 aa+eengg++esnPf+aravr+ylrevre XP_007205822.1 139 AAYEENGGRPESNPFGARAVRIYLREVRE 167 ***************************97 PP
Or compare XP_007205822.1 to CDD or PaperBLAST