XP_015641748.1 has 277 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-69 217.4 0.0 4.6e-69 216.7 0.0 1.3 1 XP_015641748.1 Domain annotation for each sequence (and alignments): >> XP_015641748.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 216.7 0.0 4.6e-69 4.6e-69 8 126 .] 18 135 .. 14 135 .. 0.98 Alignments for each domain: == domain 1 score: 216.7 bits; conditional E-value: 4.6e-69 ALOG_dom 8 PkalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrlraafee 102 P + sryesqkrrdw+tf qyl+n+rPPlel+rcsgahvleflryldqfGktkvha+ c+ffG+++p+apc cPlrqawGsldal+Grlraafee XP_015641748.1 18 P-RPSRYESQKRRDWHTFGQYLRNHRPPLELSRCSGAHVLEFLRYLDQFGKTKVHAAGCPFFGHPSPPAPCPCPLRQAWGSLDALVGRLRAAFEE 111 4.77******************************************************************************************* PP ALOG_dom 103 nggkaesnPfaaravrvylrevre 126 +gg++e+nPf+aravr+ylrevr+ XP_015641748.1 112 HGGRPEANPFGARAVRLYLREVRD 135 ***********************8 PP
Or compare XP_015641748.1 to CDD or PaperBLAST