XP_016732548.2 has 216 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-72 227.1 0.0 4.7e-72 226.3 0.0 1.3 1 XP_016732548.2 Domain annotation for each sequence (and alignments): >> XP_016732548.2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 226.3 0.0 4.7e-72 4.7e-72 2 126 .] 55 179 .. 54 179 .. 0.98 Alignments for each domain: == domain 1 score: 226.3 bits; conditional E-value: 4.7e-72 ALOG_dom 2 ssseskPkalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrl 96 sss+++P++lsrye+qkrrdwntf qyl+n+rPPl+l+rcsgahvleflryldqfGktkvh++ c+ffG+++p+apc cPlrqawGsldaliGrl XP_016732548.2 55 SSSSTSPSTLSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFGHPNPPAPCPCPLRQAWGSLDALIGRL 149 678899***************************************************************************************** PP ALOG_dom 97 raafeenggkaesnPfaaravrvylrevre 126 raafee+ggk+e+nPf+aravr+ylrevr+ XP_016732548.2 150 RAAFEEHGGKPEANPFGARAVRLYLREVRD 179 *****************************8 PP
Or compare XP_016732548.2 to CDD or PaperBLAST