VIMSS10104016 has 509 amino acids
Query: UVB_sens_prot [M=241] Accession: PF04884.18 Description: Vitamin B6 photo-protection and homoeostasis Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-73 232.8 0.1 3e-73 232.5 0.1 1.1 1 VIMSS10104016 Domain annotation for each sequence (and alignments): >> VIMSS10104016 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 232.5 0.1 3e-73 3e-73 7 239 .. 111 352 .. 105 354 .. 0.95 Alignments for each domain: == domain 1 score: 232.5 bits; conditional E-value: 3e-73 UVB_sens_prot 7 lveslkdvfLPkGyPdsVtedYleYqiwdslqafassiagvlatqavlkgvGVGdss.......asptaaallwvlkDglgrlgtilfAarlgtsl 95 l ++++d+++P+G+P sV++dYl+Y++w++ ++++++i++vl t ++lk+vGVG+ s a ++aaa++wv kDg+g+lg++l++ r+g+ + VIMSS10104016 111 LPDVVRDFVFPSGFPGSVSDDYLDYMLWQFPTNITGWICNVLVTSSLLKAVGVGSFSgtsaaatAAASAAAIRWVSKDGIGALGRLLIGGRFGSLF 206 66899************************************************99887777777888999************************** PP UVB_sens_prot 96 dselKkwrlvadvlndlamllellsplfpslfllllclasvlkslagvaagatraslsqhfAkkgNladvsAKdesqetvvsllGlllGilvvslv 191 d ++K+wr++ad++ +++++++l+++l+ps flll+++++++k++a + + +++hfA++gNl++v+AK+e++e++++l+Gl++Gil++++ VIMSS10104016 207 DDDPKQWRMYADFIGSAGSFFDLATQLYPSQFLLLASTGNLAKAVARGLRDPSFRVIQNHFAISGNLGEVAAKEEVWEVAAQLIGLGFGILIIDTP 302 **********************************************************************************************99 PP UVB_sens_prot 192 sssta..ltwlllllllalhlllnykavravklrtLNrqRasivleayle 239 ++ +++l+++ + ++hl+l y+++ +++++t+N +Ra+i++e+++ VIMSS10104016 303 GLVKSfpFVLLTWTSIRLVHLWLRYQSLAVLQFNTVNLKRARIIVESHVV 352 66666557899**********************************99875 PP
Or compare VIMSS10104016 to CDD or PaperBLAST