PaperBLAST – Find papers about a protein or its homologs

 

Align BRENDA::A9QXC9 to PF05057 (DUF676)

BRENDA::A9QXC9 has 364 amino acids

Query:       DUF676  [M=219]
Accession:   PF05057.14
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.8e-09   23.5   0.0    2.9e-09   22.9   0.0    1.2  1  BRENDA::A9QXC9  


Domain annotation for each sequence (and alignments):
>> BRENDA::A9QXC9  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   22.9   0.0   2.9e-09   2.9e-09       8     102 ..      55     146 ..      54     172 .. 0.82

  Alignments for each domain:
  == domain 1  score: 22.9 bits;  conditional E-value: 2.9e-09
          DUF676   8 vVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliaraaiaklke 102
                     ++l HGl g     + + e+++ i+++l+++   +   + +  ++ +g +  ge+l+ +v  v+ +   +  k+ +vghS+Ggl +r++ a++ +
  BRENDA::A9QXC9  55 IILEHGLSGTD-KYAGVLEYWYGIQQDLQQNGAAVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGAT--KVNLVGHSQGGLSSRYVAAVAPD 146
                     57889998864.46678899999*99****9999999999999********************9999998..****************9886663 PP



Or compare BRENDA::A9QXC9 to CDD or PaperBLAST