PaperBLAST – Find papers about a protein or its homologs

 

Align BRENDA::Q75NT4 to PF05057 (DUF676)

BRENDA::Q75NT4 has 364 amino acids

Query:       DUF676  [M=219]
Accession:   PF05057.14
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.6e-11   30.3   0.0    2.6e-11   29.5   0.0    1.3  1  BRENDA::Q75NT4  


Domain annotation for each sequence (and alignments):
>> BRENDA::Q75NT4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   29.5   0.0   2.6e-11   2.6e-11       8     102 ..      55     146 ..      53     173 .. 0.83

  Alignments for each domain:
  == domain 1  score: 29.5 bits;  conditional E-value: 2.6e-11
          DUF676   8 vVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliaraaiaklke 102
                     ++lvHGl g     + + e+++ i+e+l+++   +   + +  ++ +g +  ge+l+ +v  v+ +      k+ +vghS+Ggl++r++ a++ +
  BRENDA::Q75NT4  55 IILVHGLTGTD-KYAGVLEYWYGIQEDLQQHGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGAA--KVNLVGHSQGGLTSRYVAAVAPD 146
                     79*******75.46778899***********99999999999*******************999998888..****************9886663 PP



Or compare BRENDA::Q75NT4 to CDD or PaperBLAST