PaperBLAST – Find papers about a protein or its homologs

 

Align CharProtDB::CH_019456 to PF05057 (DUF676)

CharProtDB::CH_019456 has 364 amino acids

Query:       DUF676  [M=219]
Accession:   PF05057.14
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
    2.3e-12   33.0   0.0    3.9e-12   32.3   0.0    1.2  1  CharProtDB::CH_019456  


Domain annotation for each sequence (and alignments):
>> CharProtDB::CH_019456  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   32.3   0.0   3.9e-12   3.9e-12       8     102 ..      55     146 ..      54     173 .. 0.83

  Alignments for each domain:
  == domain 1  score: 32.3 bits;  conditional E-value: 3.9e-12
                 DUF676   8 vVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliara 95 
                            ++lvHGl g  +  + + e+++ i+e+l+++   +   + +  ++ +g +  ge+l+ +v  v+ +   +  k+ +vghS+Ggl++r+
  CharProtDB::CH_019456  55 IILVHGLSGTDK-YAGVVEYWYGIQEDLQQNGATVYVANLSGFQSDDGANGRGEQLLAYVKTVLAATGAT--KVNLVGHSQGGLTSRY 139
                            69*****99754.6778899***********99999999999*********************9999998..**************** PP

                 DUF676  96 aiaklke 102
                            + a++ +
  CharProtDB::CH_019456 140 VAAVAPD 146
                            9886663 PP



Or compare CharProtDB::CH_019456 to CDD or PaperBLAST