PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001099001.1 to PF05057 (DUF676)

NP_001099001.1 has 1319 amino acids

Query:       DUF676  [M=219]
Accession:   PF05057.14
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.2e-65  207.2   0.0    1.9e-65  206.5   0.0    1.3  1  NP_001099001.1  


Domain annotation for each sequence (and alignments):
>> NP_001099001.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  206.5   0.0   1.9e-65   1.9e-65       2     218 ..    1049    1243 ..    1048    1244 .. 0.96

  Alignments for each domain:
  == domain 1  score: 206.5 bits;  conditional E-value: 1.9e-65
          DUF676    2 skkdhLvVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliar 94  
                      ++ +hL+V+vHGl+gnsaDl+l+k+++e+    lp  +i flmse+n+++tf+++d +++rl++e++++++ ++ + +kiSf+ghSlG+li+r
  NP_001099001.1 1049 EDGVHLIVCVHGLDGNSADLRLVKTYIEL---GLPGGRIDFLMSERNQNDTFADFDSMTDRLLDEIIQYIQIYSLTVSKISFIGHSLGNLIIR 1138
                      6889*************************...9************************************************************ PP

          DUF676   95 aaiaklkekemtlkeaikglepvtfitlasPhLGvlysskslinlglalleklkkslsmeqlgltGrdLflkddkdeknsllykllkdekdlk 187 
                      +++++++ k + l+      +++tf++l++PhLG+ly+s++l+n+gl++++k+kks s+ ql+++       d++d ++++lykl++++    
  NP_001099001.1 1139 SVLTRPRFKYY-LN------KLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCR-------DHSDPRQTFLYKLSNKAG--- 1214
                      *******8874.67......8********************************************.......*************99998... PP

          DUF676  188 liealklFkrrvlyanvvndrivplas...essk 218 
                          l++Fk++vl++++ +dr+vp++s   e++k
  NP_001099001.1 1215 ----LHYFKNVVLVGSL-QDRYVPYHSariEMCK 1243
                      ....9**********77.*********9888887 PP



Or compare NP_001099001.1 to CDD or PaperBLAST