PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::P22088 to PF05057 (DUF676)

SwissProt::P22088 has 364 amino acids

Query:       DUF676  [M=219]
Accession:   PF05057.14
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    4.7e-11   28.7   0.0    7.7e-11   28.0   0.0    1.2  1  SwissProt::P22088  


Domain annotation for each sequence (and alignments):
>> SwissProt::P22088  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   28.0   0.0   7.7e-11   7.7e-11       8     102 ..      55     146 ..      54     172 .. 0.84

  Alignments for each domain:
  == domain 1  score: 28.0 bits;  conditional E-value: 7.7e-11
             DUF676   8 vVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliaraaiak 99 
                        ++lvHGl g     + + e+++ i+e+l+++   +   + +  ++ +g +  ge+l+ +v  v+ +   +  k+ +vghS+Ggl +r++ a+
  SwissProt::P22088  55 IILVHGLSGTD-KYAGVLEYWYGIQEDLQQNGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGAT--KVNLVGHSQGGLSSRYVAAV 143
                        69*****9975.56778899***********99999999999*********************9999998..****************9886 PP

             DUF676 100 lke 102
                        + +
  SwissProt::P22088 144 APD 146
                        663 PP



Or compare SwissProt::P22088 to CDD or PaperBLAST