PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q05489 to PF05057 (DUF676)

SwissProt::Q05489 has 358 amino acids

Query:       DUF676  [M=219]
Accession:   PF05057.14
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      3e-12   32.6   0.0    4.9e-12   31.9   0.0    1.2  1  SwissProt::Q05489  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q05489  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   31.9   0.0   4.9e-12   4.9e-12       8     128 ..      50     155 ..      48     166 .. 0.84

  Alignments for each domain:
  == domain 1  score: 31.9 bits;  conditional E-value: 4.9e-12
             DUF676   8 vVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliaraaiak 99 
                        v+lvHGl g  + ++ + ++++ i+++l+ +   +   + +  ++ +g +  ge+l+ +v +v+ +   +  k+ ++ghS+Ggl++r++ a+
  SwissProt::Q05489  50 VILVHGLAGT-DKFANVVDYWYGIQSDLQSHGAKVYVANLSGFQSDDGPNGRGEQLLAYVKQVLAATGAT--KVNLIGHSQGGLTSRYVAAV 138
                        8******996.56788889************9999999999999*********************99999..****************9886 PP

             DUF676 100 lkekemtlkeaikglepvtfitlasPhLG 128
                        + +                 +t+ +Ph G
  SwissProt::Q05489 139 APQLV------------ASVTTIGTPHRG 155
                        65221............223455555555 PP



Or compare SwissProt::Q05489 to CDD or PaperBLAST