PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9P2D6 to PF05057 (DUF676)

SwissProt::Q9P2D6 has 1515 amino acids

Query:       DUF676  [M=219]
Accession:   PF05057.14
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.2e-65  207.2   0.0    2.4e-65  206.2   0.0    1.5  1  SwissProt::Q9P2D6  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9P2D6  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  206.2   0.0   2.4e-65   2.4e-65       2     218 ..    1245    1439 ..    1244    1440 .. 0.96

  Alignments for each domain:
  == domain 1  score: 206.2 bits;  conditional E-value: 2.4e-65
             DUF676    2 skkdhLvVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgl 91  
                         ++ +hL+V+vHGl+gnsaDl+l+k+++e+    lp  +i flmse+n+++tf+++d +++rl++e++++++ ++ + +kiSf+ghSlG+l
  SwissProt::Q9P2D6 1245 EDGVHLIVCVHGLDGNSADLRLVKTYIEL---GLPGGRIDFLMSERNQNDTFADFDSMTDRLLDEIIQYIQIYSLTVSKISFIGHSLGNL 1331
                         6889*************************...9********************************************************* PP

             DUF676   92 iaraaiaklkekemtlkeaikglepvtfitlasPhLGvlysskslinlglalleklkkslsmeqlgltGrdLflkddkdeknsllykllk 181 
                         i+r+++++++ k + l+      +++tf++l++PhLG+ly+s++l+n+gl++++k+kks s+ ql+++       d++d ++++lykl++
  SwissProt::Q9P2D6 1332 IIRSVLTRPRFKYY-LN------KLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCR-------DHSDPRQTFLYKLSN 1407
                         **********8874.67......8********************************************.......*************99 PP

             DUF676  182 dekdlkliealklFkrrvlyanvvndrivplas...essk 218 
                         ++        l++Fk++vl++++ +dr+vp++s   e++k
  SwissProt::Q9P2D6 1408 KAG-------LHYFKNVVLVGSL-QDRYVPYHSariEMCK 1439
                         998.......9**********77.*********9888887 PP



Or compare SwissProt::Q9P2D6 to CDD or PaperBLAST