PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10079218 to PF05057 (DUF676)

VIMSS10079218 has 412 amino acids

Query:       DUF676  [M=219]
Accession:   PF05057.14
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    4.8e-69  218.3   0.0    7.5e-69  217.7   0.0    1.2  1  VIMSS10079218  


Domain annotation for each sequence (and alignments):
>> VIMSS10079218  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  217.7   0.0   7.5e-69   7.5e-69       2     214 ..      77     302 ..      76     307 .. 0.95

  Alignments for each domain:
  == domain 1  score: 217.7 bits;  conditional E-value: 7.5e-69
         DUF676   2 skkdhLvVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliaraai 97 
                     +++hLvV+v+Gl g+ +++++ ++q+ k   k+p++ +++++++n +++tf+g+dv+gerlaeev++v+k+  +  +kiSfvghSlGgliar+ai
  VIMSS10079218  77 TEPTHLVVMVNGLIGSAQNWRFAAKQMLK---KYPQDLLVHCSKRNHSTQTFDGVDVMGERLAEEVRSVIKRHPSL-QKISFVGHSLGGLIARYAI 168
                    5799*************************...9*******************************************.8****************** PP

         DUF676  98 aklkekem..................tlkeaikglepvtfitlasPhLGvlysskslinlglalleklkkslsmeqlgltGrdLflkddkdeknsl 175
                    ++l+e+e                   + k++i+glepv fit a+PhLG+++++++++ +g   le+l++ +  + lg+tG++Lfl+d++  k++l
  VIMSS10079218 169 GRLYEQESreelphnsddigdkcsieEPKARIAGLEPVYFITSATPHLGSRGHKQVPLFSGSYTLERLAT-RMSGCLGKTGKHLFLADSDGGKPPL 263
                    ****99999999999998887766543899***************************************9.899********************** PP

         DUF676 176 lykllkdekdlkliealklFkrrvlyanvvndrivplas 214
                    l++++kd+ dlk+i+al+ Fkrr++yan+  d++v   +
  VIMSS10079218 264 LLRMVKDSRDLKFISALQCFKRRIAYANTSFDHLVGWST 302
                    *****************************9999997776 PP



Or compare VIMSS10079218 to CDD or PaperBLAST