PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10102319 to PF05057 (DUF676)

VIMSS10102319 has 418 amino acids

Query:       DUF676  [M=219]
Accession:   PF05057.14
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    5.3e-78  247.6   0.0    8.1e-78  247.0   0.0    1.2  1  VIMSS10102319  


Domain annotation for each sequence (and alignments):
>> VIMSS10102319  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  247.0   0.0   8.1e-78   8.1e-78       2     214 ..      89     310 ..      88     315 .. 0.96

  Alignments for each domain:
  == domain 1  score: 247.0 bits;  conditional E-value: 8.1e-78
         DUF676   2 skkdhLvVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliaraai 97 
                    +k+dhLvV+v+G+ g+ aD+++ +eq++k   k+p++++++++++n+++ tf+g+d +gerla+evl vvk+++   kkiSfv+hSlGgl+ar+ai
  VIMSS10102319  89 EKPDHLVVMVNGIVGSAADWKYAAEQFVK---KFPDKVLVHRSESNSATLTFDGVDKMGERLANEVLGVVKHRSGL-KKISFVAHSLGGLVARYAI 180
                    689**************************...9******************************************9.8****************** PP

         DUF676  98 aklkekem...........t..lkeaikglepvtfitlasPhLGvlysskslinlglalleklkkslsmeqlgltGrdLflkddkdeknsllykll 180
                    +kl+e++            +  + ++i+glep++fit+a+PhLG++++++++i++gl++le++++++++ + g+tG++Lfl+d++d + +ll++++
  VIMSS10102319 181 GKLYEQPGevdsldspskeKsaRGGEIAGLEPMNFITFATPHLGSRGHRQFPILCGLPFLERTASQTAHLAAGRTGKHLFLVDNDDGNAPLLIRMA 276
                    ****999999998887765156999*********************************************************************** PP

         DUF676 181 kdekdlkliealklFkrrvlyanvvndrivplas 214
                    +d++dlk+i+al++Fkrrv+yanv  d++v  ++
  VIMSS10102319 277 TDSDDLKFISALNAFKRRVAYANVNFDSMVGWRT 310
                    ************************9999998877 PP



Or compare VIMSS10102319 to CDD or PaperBLAST