PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10109580 to PF05057 (DUF676)

VIMSS10109580 has 357 amino acids

Query:       DUF676  [M=219]
Accession:   PF05057.14
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    3.4e-78  248.2   0.0    6.5e-78  247.3   0.0    1.4  2  VIMSS10109580  


Domain annotation for each sequence (and alignments):
>> VIMSS10109580  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  247.3   0.0   6.5e-78   6.5e-78       2     214 ..      31     253 ..      30     260 .. 0.96
   2 ?   -3.6   0.0      0.35      0.35     180     202 ..     312     336 ..     297     347 .. 0.63

  Alignments for each domain:
  == domain 1  score: 247.3 bits;  conditional E-value: 6.5e-78
         DUF676   2 skkdhLvVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliaraai 97 
                    s++dhLvV+vHG+ g+++D+++ +eq++k   k+p++++++++++n ++ t +g+dv+gerla evl+++++k +  +kiSfv+hSlGgl ar+ai
  VIMSS10109580  31 SSADHLVVMVHGILGSTDDWKFGAEQFVK---KMPDKVFVHCSEKNVSALTLDGVDVMGERLAAEVLDIIQRKPNI-CKISFVAHSLGGLAARYAI 122
                    6799*************************...9******************************************9.9****************** PP

         DUF676  98 aklkekem..............tlkeaikglepvtfitlasPhLGvlysskslinlglalleklkkslsmeqlgltGrdLflkddkdeknsllykl 179
                    +kl++ ++              t k++i+gle+++fit+a+PhLG+++++++++++g++ +ek++  + ++++++tGr+Lflkd+++ k++ll ++
  VIMSS10109580 123 GKLYKPANqedvkdsvadssqeTPKGTICGLEAMNFITVATPHLGSMGNKQVPFLFGFSSIEKVAGLIIHWIFKRTGRHLFLKDEEEGKPPLLRRM 218
                    ****999999999888877654499*********************************************************************** PP

         DUF676 180 lkdekdlkliealklFkrrvlyanvvndrivplas 214
                    ++d++d+++i+al++Fkrrv+y+nv +d++v  ++
  VIMSS10109580 219 VEDTDDCHFISALRAFKRRVAYSNVGHDHVVGWKT 253
                    ******************************99888 PP

  == domain 2  score: -3.6 bits;  conditional E-value: 0.35
         DUF676 180 lkdekdlkliealklF..krrvlya 202
                    + ++ d+++ +++++F   ++++++
  VIMSS10109580 312 SWEKVDVSFHSSRQRFaaHSVIQVK 336
                    4455566777777777444444444 PP



Or compare VIMSS10109580 to CDD or PaperBLAST